PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H01775.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 117aa    MW: 13738.6 Da    PI: 9.5414
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H01775.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY62.47.8e-20965360
                      -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY  3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60
                      D+y W  YG+++v g++fp  YYrC+++gC+v+kk  rs   ++++ei+Y+++H+h+k
  Migut.H01775.2.p  9 DEYLWIQYGKRVVGGNDFPVRYYRCSYPGCTVRKKCVRSP-TGEITEIVYRDSHHHPK 65
                      9***************************************.9**************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081116.386266IPR003657WRKY domain
SuperFamilySSF1182904.18E-16466IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-16566IPR003657WRKY domain
SMARTSM007741.3E-10765IPR003657WRKY domain
PfamPF031062.2E-14964IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MTGHTLPYDE YLWIQYGKRV VGGNDFPVRY YRCSYPGCTV RKKCVRSPTG EITEIVYRDS  60
HHHPKPHLID IDLSFATRDG GKSIRRLQIR YYDLRWQAQP WYPSCRESRN IIFSGP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804327.14e-18PREDICTED: probable WRKY transcription factor 20 isoform X1
SwissprotQ8S8P54e-16WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A0N7KBZ08e-18A0A0N7KBZ0_SOLTU; Transcription factor
TrEMBLM1C0Z48e-18M1C0Z4_SOLTU; Uncharacterized protein
TrEMBLK4CHK58e-18K4CHK5_SOLLC; Uncharacterized protein
STRINGPGSC0003DMT4000574092e-17(Solanum tuberosum)
STRINGSolyc07g065260.2.12e-17(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.12e-17WRKY DNA-binding protein 33